PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019085
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 381aa    MW: 42052.8 Da    PI: 5.1436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019085genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT +Ed++lv +++++G g W+t + + g+ R++k+c++rw +yl
      Lus10019085 14 KGAWTSDEDQKLVSYIQEHGEGGWRTLPLKAGLQRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding60.43.9e-1967112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE+++++d+++ lG++ W++Iar+++ +Rt++++k++w+++l
      Lus10019085  67 RGEFSPEEEQRIIDLHASLGNR-WSAIARHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-22564IPR009057Homeodomain-like
PROSITE profilePS5129413.757961IPR017930Myb domain
SuperFamilySSF466891.01E-2811108IPR009057Homeodomain-like
SMARTSM007173.9E-101363IPR001005SANT/Myb domain
PfamPF002499.5E-141461IPR001005SANT/Myb domain
PROSITE profilePS5129427.39662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2765116IPR009057Homeodomain-like
SMARTSM007173.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.8E-1767112IPR001005SANT/Myb domain
CDDcd001675.61E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGRTPCCNVD GLKKGAWTSD EDQKLVSYIQ EHGEGGWRTL PLKAGLQRCG KSCRLRWANY  60
LRPDIKRGEF SPEEEQRIID LHASLGNRWS AIARHLPKRT DNEIKNYWNT HLKKRLCDNI  120
DPTSHNNNKT LGPATSTTSA DVDQPSHIHV STSSSSAQLL NKLAAKLAQE EEEGRENDVV  180
PRPIRRVGSS SSSARLLNKM ASRLAQPMHC LNTLKSILSS AAAESDGGDY GNNMQRCAST  240
SSLQSESTAA TSSNVSRSND FNTADYNDEN MAFLDTLDLD SVLNDDEWPR QQQQQYGSSS  300
TLLFGGSQYS LDYDYGYGSM DLEQPSTTSS ASKSTSNDHV DDSCYDYGYG GEQIGADDYN  360
HRLGGLLDGD DEHGRTLWNF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9SPG54e-76MYB76_ARATH; Transcription factor MYB76
STRINGAT5G07700.11e-73(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07700.16e-71myb domain protein 76